PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_45408.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 110aa    MW: 12305.9 Da    PI: 9.6841
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_45408.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.11e-155613491
                             SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                       B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91
                             +++ l  ++gr+W  k++ + k+gr+ l++GW++F++an+Lk+gD+++ +l++++e++
  Rsa1.0_45408.1_g00001.1  5 RMIYLLGRDGRKWLSKVQ-QDKKGRVSLGNGWRDFAEANNLKSGDSFTMELIWEEETR 61
                             5799*************6.5555789***************************85543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010194.6E-5169IPR003340B3 DNA binding domain
PROSITE profilePS5086313.479169IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-14272IPR015300DNA-binding pseudobarrel domain
CDDcd100176.45E-13265No hitNo description
SuperFamilySSF1019367.65E-14364IPR015300DNA-binding pseudobarrel domain
PfamPF023621.0E-13561IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MNKLRMIYLL GRDGRKWLSK VQQDKKGRVS LGNGWRDFAE ANNLKSGDSF TMELIWEEET  60
RMLRLSGAES SSSKAYVSTE PGSSSDSSSA IQNRSVTLTL TPEEVRACKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604125.13e-54PREDICTED: B3 domain-containing protein REM13-like isoform X1
RefseqXP_013604126.13e-54PREDICTED: B3 domain-containing protein REM13-like isoform X2
RefseqXP_013604127.12e-54PREDICTED: B3 domain-containing protein REM13-like isoform X3
RefseqXP_013660737.13e-54PREDICTED: B3 domain-containing protein REM13-like
SwissprotP0CAP53e-32REM13_ARATH; B3 domain-containing protein REM13
TrEMBLA0A0D3DVL74e-54A0A0D3DVL7_BRAOL; Uncharacterized protein
STRINGBra007840.1-P2e-52(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24650.13e-28DNA binding;DNA binding;sequence-specific DNA binding transcription factors